PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo9G0002500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Nin-like
Protein Properties Length: 243aa    MW: 27535.6 Da    PI: 9.3154
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo9G0002500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK62.76.5e-20133178348
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48 
                      ++++ d+++yF+lp ++AA++L++c T+LK+  R+++++RWPhRk
  Spipo9G0002500 133 RQLTFTDIAQYFHLPANEAAQKLQICSTALKKVSRKFNLNRWPHRK 178
                     689******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151913.06124203IPR003035RWP-RK domain
PfamPF020423.8E-19134179IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MEEIDEVFRF LDSPQGKELC ELLSSLLSSD EELPPPPEPT LQQDNVVDSG NGVSPVPITV  60
TWMPFSGADC GRCHLLRDIV HAGGHLNMEQ GSTVHRNTSR ANVYTNVISN QYQKRRVDFI  120
SEGQGSLVRH RIRQLTFTDI AQYFHLPANE AAQKLQICST ALKKVSRKFN LNRWPHRKFI  180
IELRVFRMYG RIRNVHALSV LSDLKLGHYA NILSRCMFTS QVRARRLCGL HLSLFNTPLS  240
PV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP80552944
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.16e-08RWP-RK domain-containing protein